status: beta

Turn Fedora into a pentest machine.

Pendora is a modular installation framework that transforms a standard Fedora Linux install into a penetration testing and security assessment VM — bringing Kali's toolset, workflows, and aesthetics to Fedora's modern Wayland, RPM/DNF, and systemd ecosystem.

user@host:~
$ git clone https://github.com/sec-moose/pendora && cd pendora && ./install.sh --basic▊
FedoraBashLuaDockerQEMU/KVMKali ToolsSway

// architecture

Four tiers. Fully modular.

Tooling, services, and configuration are organized into dedicated tiers — each a plain list you can read, edit, and extend.

01

Native DNF RPMs

pkg-lists/

109 packages verified against official Fedora repos — base compilers, networking, sniffers, web discovery, reversing, and forensics.

scannersdebuggerssniffersforensics
02

Pipx Isolated Tools

pipx-lists/

Offensive Python utilities in isolated environments, safe from system library conflicts.

netexecimpacketcertipy-adsqlmapresponder
03

Upstreams & Containers

upstreams/

Vendor installers, git clones, and Docker containers for enterprise suites.

metasploitburpsuitebloodhoundrustscansysreptor
04

Shell & Look-and-Feel

zsh/

Interactive Zsh with autosuggestions, syntax highlighting, completions, and pentesting aliases.

zshcompletionsaliases

// install

Keep GNOME, or go full tiling.

All three modes are tested and verified on Fedora Workstation VMs. Installing Sway never removes GNOME — pick your session at the GDM login screen.

RECOMMENDED

Basic Pentest

./install.sh --basic (-b)

Keeps your default Fedora GNOME desktop intact while deploying all pentest CLI tools (00–60), Pipx tools, Docker container suites, Zsh, Neovim, and Alacritty. Zero desktop changes.

Sway Desktop

./install.sh --sway (-W)

Lightweight Sway tiling compositor with the Noctalia shell, Hack Nerd Font, focus-based window opacity, and SPICE host/guest clipboard sharing. 100% native Fedora RPMs — zero COPR repos. Switch between GNOME and Sway at the login screen.

Full Install

./install.sh --all (-a)

Single-pass end-to-end deployment of everything in Basic plus the full Sway desktop stack (70-sway.list, dotfiles, screensharing portal services).

baseline 4 vCPU · 4 GB RAM · 25 GB disk
recommended 8 vCPU · 8 GB RAM · 35–50 GBtarget: QEMU/KVM VM · ~11 GB footprint

// preview

Two desktops. One framework.

Keep Fedora's GNOME with --basic, or deploy the dynamic Sway tiling desktop with --sway — both tested and verified on QEMU/KVM.

$ --sway — Sway dynamic tiling desktop (Noctalia shell + Catppuccin Alacritty + focus opacity)

pendora@pendora: ~ — Sway · Noctalia shell
Pendora Sway dynamic tiling desktop with the Noctalia shell, Catppuccin-themed Alacritty terminals, and focus-based window opacity

$ --basic — Fedora GNOME pentest desktop

pendora@pendora: ~ — GNOME · Fedora Workstation
Pendora desktop after a finished --basic install: GNOME on Fedora with Impacket, btop, and fastfetch open in Catppuccin-themed terminals

// about

The full story, in plain text.

user@host:~ $ cat PENDORA.md

Pendora is a modular installation framework and configuration template that transforms a standard Fedora Linux installation into a penetration testing and security assessment virtual machine — bringing the toolset, workflows, and aesthetics of Kali Linux to Fedora's modern ecosystem (Wayland, RPM/DNF, systemd).

Everything is organized into four plain-text, human-editable tiers:

  1. 1

    Native Fedora RPMs (pkg-lists/) — 109 packages verified against official Fedora repos: compilers, networking, sniffers, web discovery, reversing, and forensics.

  2. 2

    Pipx-isolated Python tools (pipx-lists/) — netexec, impacket, certipy-ad, sqlmap, responder, and more, safe from system library conflicts.

  3. 3

    Upstreams & containers (upstreams/) — Metasploit, Burp Suite, SecLists, OWASP ZAP, RustScan, Portainer, SysReptor, and BloodHound CE.

  4. 4

    Shell & look-and-feel (zsh/) — Kali-style Zsh prompt, autosuggestions, syntax highlighting, and pentesting aliases.

A single script, install.sh, deploys everything with three tested and verified modes: --basic (keeps GNOME, deploys all CLI tooling), --sway (adds the Sway tiling desktop with the Noctalia shell, Hack Nerd Font, and focus-based opacity — 100% native RPMs, zero COPR), and --all (everything in one pass). GNOME and Sway can be switched freely at the GDM login screen.

Containerized suites land ready on localhost: SysReptor reporting :8000, BloodHound CE :8080, and Portainer :7999 (work in progress). Target environment is a QEMU/KVM VM (baseline 4 vCPU / 4 GB / 25 GB; recommended 8 vCPU / 8 GB / 35–50 GB; ~11 GB install footprint).

Status: Beta — all three install modes verified on Fedora Workstation VMs, with continuous testing underway. Parts of the project were developed with AI assistance; some upstream modules execute vendor scripts directly — inspect all scripts before running, and use entirely at your own risk.

// dashboards

Containerized suites, ready on localhost.

Portainer

localhost:7999work in progress

SysReptor

localhost:8000

BloodHound

localhost:8080

Use entirely at your own risk

Pendora is provided "as is" without warranty of any kind. Some upstream modules fetch and execute vendor installation scripts directly — inspect all scripts before running them. Parts of this project were developed with AI assistance. Intended for authorized security testing and lab environments only.

// roadmap

Where it's headed.

Synced live from TODO.md in the repo — updates on GitHub show up here on their own, no republish needed.

user@host:~ $ pendora roadmap --todo

## Bugfixes & Active Investigations

  • [ ]

    Portainer CE Deployment

    • └Debug and resolve initialization failure during upstream installation (upstreams/install-upstreams.sh).
    • └Ensure Portainer runs reliably alongside SysReptor and BloodHound CE.
  • [ ]

    Sway VM Display Auto-Rescaling

    • └Investigate dynamic display rescaling on window drag under QEMU/SPICE virtual machines (currently defaults to fixed 1080p).

## Tooling & Upstream Additions

  • [ ]

    ADWS Domain Dump (r4cken fork)

  • [ ]

    Nuclei

  • [ ]

    Coercer

  • [ ]

    Programming Language Libraries

    • └Common development and offensive tooling libraries/headers across primary languages.

## Desktop Environment & UX Polish

  • [ ]

    Rofi Theme Customization

    • └Add native Catppuccin Macchiato / Pendora colorway for Rofi launcher ($mod+Shift+space).
  • [ ]

    Noctalia Widgets & Bar Polish

    • └Configure custom status bar items (VPN tunnel status tun0/wg0, IP address widget, system resource monitors).

## Framework & Installer Improvements

  • [ ]

    Minimal vs. Full Installation Profiles

    • └Provide distinct installation modes: a minimal/streamlined profile for essentials and basics only, and a comprehensive full profile that installs every available tool and upstream integration.
  • [ ]

    Self-Check / Verification Subcommand

    • └Add ./install.sh --verify to test if all tools, services, and symlinks are installed and responsive.
  • [ ]

    Modular Uninstall / Cleanup

    • └Add ./install.sh --clean or module removal option to safely un-stow configurations and purge unused cache files.
  • [ ]

    Air-Gapped / Offline Deployment

    • └Support pre-cached RPMs and container tarballs for offline lab deployment.

$ pendora roadmap --todo | 12 open tasks · synced from TODO.md · 2026-10-04▊

// faq

Questions, answered.

The things people ask before running an unknown install script on a fresh VM.

user@host:~ $ pendora faq --list

?What exactly is Pendora?

A modular installation framework and configuration template that turns a standard Fedora Linux install into a full penetration testing and security assessment VM — Kali's toolset and workflows, running natively on Fedora's RPM/DNF, Wayland, and systemd ecosystem.

?Why was Pendora developed?

Honestly? I wanted a familiar environment. Kali is great, but I enjoy Fedora far more — and since my host runs Fedora with Hyprland, I wanted that same feeling in my pentest VM. Manually reinstalling every package after a fresh setup, with no snapshots or backups to fall back on, was exactly the problem Pendora solves. I also wanted to give something back to the open-source community — and somewhere around that point, the idea of Pendora was born.

?Who is Pendora made for?

Penetration testers and red teamers who want a complete assessment VM in minutes; students and CTF players learning on professional tooling in an isolated QEMU/KVM sandbox; Fedora users who want Kali's toolset without leaving DNF, Wayland, and systemd behind; and homelab or blue-team folks who need the networking packages plus SysReptor and BloodHound CE on localhost.

?Do I need to wipe my Fedora install or dual-boot?

No. Pendora runs as a single script, ./install.sh, on top of an existing Fedora installation. Everything is organized into plain-text lists you can read and edit before running anything. It's built and tested for a QEMU/KVM VM — snapshot your VM and you can always roll back.

?Will installing Sway remove my GNOME desktop?

Never. Installing Sway adds a second session — GNOME stays exactly where it is. Switch between the two at the GDM login screen, any time.

?Which install mode should I pick?

--basic if you want to keep your GNOME desktop and just get the tooling (recommended). --sway if you want the lightweight Sway tiling desktop with the Noctalia shell. --all if you want everything in a single pass.

?What are the system requirements?

Baseline: 4 vCPU, 4 GB RAM, 25 GB disk. Recommended: 8 vCPU, 8 GB RAM, 35–50 GB. The install footprint is roughly 11 GB, and the target environment is a QEMU/KVM virtual machine.

?What do I get running out of the box?

109 native Fedora RPMs, Pipx-isolated Python tools (netexec, impacket, certipy-ad, sqlmap, responder…), containerized suites — SysReptor on :8000, BloodHound CE on :8080, Portainer on :7999 (work in progress) — plus a Kali-style Zsh shell with pentesting aliases.

?Can I add my own tools?

Yes — that's the point. The four tiers are plain-text lists under pkg-lists/, pipx-lists/, upstreams/, and zsh/. Edit them directly, or use the suggest-tool form on the tools page to open a pre-filled GitHub issue.

?Is it production-ready?

It's in beta: all three install modes are verified on Fedora Workstation VMs with continuous testing underway. Parts of the project were developed with AI assistance, and some upstream modules execute vendor scripts directly — inspect everything before running, and use entirely at your own risk.

$ pendora faq --list | 10 entries · more in the README▊

Clone it. Read it. Run it.

View on GitHub

pendora — a modular pentest VM framework for fedora linux